PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000256730
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 140aa    MW: 15808.2 Da    PI: 4.1476
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000256730genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM384.8e-12941134
            NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevi 34
                   l+pGfrFhPtdeelv++yLk+kv+gk++++ + i
  MDP0000256730  9 LAPGFRFHPTDEELVWYYLKRKVSGKNFRF-DPI 41
                   579************************887.444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.72E-12650IPR003441NAC domain
PfamPF023651.4E-91154IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 140 aa     Download sequence    Send to blast
MARGKENSLA PGFRFHPTDE ELVWYYLKRK VSGKNFRFDP ISKDPYVLCR IFQKSGTGPK  60
NGEKYGAPVM EEEWDDDDVT CVXGEEAAAN VVAVSEEPDN EANDFNNGAY VEAFDLDQIW  120
PEFIEFKDNS PSCGKPPDVL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.38572e-91bud| cell culture| fruit| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008339779.13e-45PREDICTED: NAC domain-containing protein 78-like isoform X2
TrEMBLD9ZJA84e-37D9ZJA8_MALDO; NAC domain class transcription factor
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.13e-17NAC domain containing protein 2